General Information

  • ID:  hor006792
  • Uniprot ID:  A0A291NT7??24-125)
  • Protein name:  Conopressin-conophysin; isoform 1
  • Gene name:  NA
  • Organism:  Conus monile
  • Family:  Vasopressin/oxytocin family
  • Source:  Human
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Caenogastropoda; Neogastropoda; Conoidea; Conidae (cone shells); Conus; Strategoconus; Conus monile (Necklace cone)
  • GO MF:  GO:0005615 extracellular space; GO:0030141 secretory granule
  • GO BP:  GO:0090729 toxin activity; GO:0005185 neurohypophyseal hormone activity
  • GO CC:  NA

Sequence Information

  • Sequence:  FIRNCPEGGKRDVHMIQPTKPCMNCSFGQCVGPRVCCGAGRCEIGSTEADRCEEENEDPVPCKVLGQHCVLNNPGNVNGNCVDGGIGICCVDDTCAIHRRCD
  • Length:  102
  • Propeptide:  MQMGRPTLLPCLLLLLVLSTQACFIRNCPEGGKRDVHMIQPTKPCMNCSFGQCVGPRVCCGAGRCEIGSTEADRCEEENEDPVPCKVLGQHCVLNNPGNVNGNCVDGGIGICCVDDTCAIHRRCD
  • Signal peptide:  MQMGRPTLLPCLLLLLVLSTQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Conopressins specific interaction with a receptor in the central nervous system and as an endogenous hormone in gastropods.
  • Mechanism:  Conopressins specific interaction with a receptor in the central nervous system and as an endogenous hormone in gastropods.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA